TG004698

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L (PE001773)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N3F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,293.37
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.128 35.383 54.012 880.239 6+ 1,060.260 4+ Y[pN] 62.1
35.128 35.383 54.012 880.239 6+ 1,096.775 4+ Y[pNF] 25.5
35.128 35.383 54.012 880.239 6+ 1,111.030 4+ Y[pN2] 21.0
35.128 35.383 54.012 880.239 6+ 1,151.543 4+ Y[pHN2] 20.4
35.128 35.383 54.012 880.239 6+ 983.058 5+ Y[pH2N2F] 20.3
35.128 35.383 54.012 880.239 6+ 1,192.056 4+ Y[pH2N2] 18.9
35.128 35.383 54.012 880.239 6+ 953.847 5+ Y[pH2N2] 16.3
35.128 35.383 54.012 880.239 6+ 921.436 5+ Y[pHN2] 15.1
35.128 35.383 54.012 880.239 6+ 1,413.344 3+ Y[pN] 12.4
35.128 35.383 54.012 880.239 6+ 1,015.469 5+ Y[pH3N2F] 11.4
35.128 35.383 54.012 880.239 6+ 950.648 5+ Y[pHN2F] 10.3
35.128 35.383 54.012 880.239 6+ 1,232.570 4+ Y[pH3N2] 8.4
35.128 35.383 54.012 880.239 6+ 986.257 5+ Y[pH3N2] 7.2
35.128 35.383 54.012 880.239 6+ 1,147.545 4+ Y[pN2F] 6.6
35.128 35.383 54.012 880.239 6+ 848.410 5+ Y[pN] 5.9

Spectra

6639;EThcD;35.097;6638;880.238;Byonic:q-value=0.000237/GPS:MinICScore=20.694
6641;HCD;35.106;6638;880.238;
6730;EThcD;35.495;6729;880.237;Byonic:q-value=5.12e-05/GPS:MinICScore=13.077
6732;HCD;35.504;6729;880.237;