TG004689

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4FS]ITEENVQNMNNAGDKWSAFLK.E (PE001762)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4FS (N27)
Mod(s)
Molecular Weight 7,559.288
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.008 75.193 155.044 1,509.263 5+ 1,462.677 4+ Y[pN] 57.2
75.008 75.193 155.044 1,509.263 5+ 1,685.756 4+ Y[pH3N3] 21.6
75.008 75.193 155.044 1,509.263 5+ 1,722.270 4+ Y[pH3N3F] 20.8
75.008 75.193 155.044 1,509.263 5+ 1,499.191 4+ Y[pNF]* 20.0
75.008 75.193 155.044 1,509.263 5+ 1,726.269 4+ Y[pH4N3] 11.5
75.008 75.193 155.044 1,509.263 5+ 1,762.783 4+ Y[pH4N3F]* 10.7
75.008 75.193 155.044 1,509.263 5+ 1,645.243 4+ Y[pH2N3] 10.5
75.008 75.193 155.044 1,509.263 5+ 1,681.757 4+ Y[pH2N3F] 10.2
75.008 75.193 155.044 1,509.263 5+ 1,594.473 4+ Y[pH2N2] 9.9
75.008 75.193 155.044 1,509.263 5+ 1,421.833 5+ Y[pH4N4] 8.2
75.008 75.193 155.044 1,509.263 5+ 1,553.960 4+ Y[pHN2] 7.5
75.008 75.193 155.044 1,509.263 5+ 1,451.044 5+ Y[pH4N4F] 6.9
75.008 75.193 155.044 1,509.263 5+ 1,513.446 4+ Y[pN2] 6.3
75.008 75.193 155.044 1,509.263 5+ 1,411.907 4+ Y[p] 5.3

Spectra

15758;EThcD;74.999;15753;1509.661;Byonic:q-value=6.57e-07/GPS:MinICScore=59.179
15760;HCD;75.008;15753;1509.661;