TG004686

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4S]ITEENVQNMNNAGDKWSAFLK.E (PE001763)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4S (N27)
Mod(s)
Molecular Weight 7,575.283
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.847 74.580 153.488 1,512.462 5+ 1,462.677 4+ Y[pN] 43.2
74.847 74.580 153.488 1,512.462 5+ 1,685.756 4+ Y[pH3N3] 14.9
74.847 74.580 153.488 1,512.462 5+ 1,513.446 4+ Y[pN2] 10.9
74.847 74.580 153.488 1,512.462 5+ 1,594.473 4+ Y[pH2N2] 5.2

Spectra

15722;EThcD;74.837;15720;1512.471;Byonic:q-value=6.79e-19/GPS:MinICScore=30.601
15724;HCD;74.847;15720;1512.471;