TG004684

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4]ITEENVQNMNNAGDKWSAFLK.E (PE001755)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4 (N27)
Mod(s)
Molecular Weight 7,284.188
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
70.685 70.682 143.596 1,454.243 5+ 1,462.677 4+ Y[pN] 47.5
70.685 70.682 143.596 1,454.243 5+ 1,726.269 4+ Y[pH4N3] 32.3
70.685 70.682 143.596 1,454.243 5+ 1,685.756 4+ Y[pH3N3] 21.1
70.685 70.682 143.596 1,454.243 5+ 1,594.473 4+ Y[pH2N2] 5.3
70.685 70.682 143.596 1,454.243 5+ 1,634.986 4+ Y[pH3N2] 5.3

Spectra

14773;EThcD;70.677;14768;1454.250;Byonic:q-value=9.57e-10/GPS:MinICScore=43.200
14775;HCD;70.685;14768;1454.250;