TG004679

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L (PE001770)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H5N4FS (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 6,111.651
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
37.493 37.565 59.550 1,219.741 5+ 1,360.367 4+ Y[pH4N3F] 70.6
37.493 37.565 59.550 1,219.741 5+ 1,319.854 4+ Y[pH3N3F] 31.4
37.493 37.565 59.550 1,219.741 5+ 1,451.650 4+ Y[pH5N4F] 25.2
37.493 37.565 59.550 1,219.741 5+ 1,637.759 3+ Y[pH2N2F]* 25.1
37.493 37.565 59.550 1,219.741 5+ 1,411.137 4+ Y[pH4N4F] 19.5
37.493 37.565 59.550 1,219.741 5+ 1,691.776 3+ Y[pH3N2F]* 17.8
37.493 37.565 59.550 1,219.741 5+ 1,589.073 3+ Y[pH2N2] 15.0
37.493 37.565 59.550 1,219.741 5+ 1,433.141 4+ Y[pH4N3FS]* 14.0
37.493 37.565 59.550 1,219.741 5+ 1,413.344 3+ Y[pN] 12.3
37.493 37.565 59.550 1,219.741 5+ 1,462.030 3+ Y[pNF]* 11.6
37.493 37.565 59.550 1,219.741 5+ 1,643.090 3+ Y[pH3N2] 11.2
37.493 37.565 59.550 1,219.741 5+ 1,323.853 4+ Y[pH4N3] 10.5
37.493 37.565 59.550 1,219.741 5+ 1,583.741 3+ Y[pHN2F]* 9.6
37.493 37.565 59.550 1,219.741 5+ 1,535.055 3+ Y[pHN2] 8.6
37.493 37.565 59.550 1,219.741 5+ 1,759.469 3+ Y[pH3N3F] 6.6
37.493 37.565 59.550 1,219.741 5+ 1,161.522 5+ Y[pH5N4F] 6.4
37.493 37.565 59.550 1,219.741 5+ 1,283.340 4+ Y[pH3N3] 5.8
37.493 37.565 59.550 1,219.741 5+ 1,710.783 3+ Y[pH3N3] 5.3

Spectra

7221;EThcD;37.667;7220;1220.141;Byonic:q-value=0.00202/GPS:MinICScore=129.280
7222;HCD;37.673;7220;1220.141;