TG004678

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4F]STEAGQK.L (PE001774)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H5N4F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,820.555
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
34.948 38.218 61.207 968.103 6+ 1,269.084 4+ Y[pH3N2F]* 38.5
34.948 38.218 61.207 968.103 6+ 1,228.571 4+ Y[pH2N2F]* 36.3
34.948 38.218 61.207 968.103 6+ 1,192.056 4+ Y[pH2N2] 25.0
34.948 38.218 61.207 968.103 6+ 1,413.344 3+ Y[pN] 20.1
34.948 38.218 61.207 968.103 6+ 1,151.543 4+ Y[pHN2] 16.9
34.948 38.218 61.207 968.103 6+ 1,232.570 4+ Y[pH3N2] 15.4
34.948 38.218 61.207 968.103 6+ 1,060.260 4+ Y[pN] 14.5
34.948 38.218 61.207 968.103 6+ 1,188.058 4+ Y[pHN2F]* 9.7
34.948 38.218 61.207 968.103 6+ 1,462.030 3+ Y[pNF]* 8.8
34.948 38.218 61.207 968.103 6+ 1,111.030 4+ Y[pN2] 8.7
34.948 38.218 61.207 968.103 6+ 1,147.545 4+ Y[pN2F]* 5.8
34.948 38.218 61.207 968.103 6+ 1,481.037 3+ Y[pN2] 5.2

Spectra

6603;EThcD;34.939;6602;968.271;Byonic:q-value=0.00202/GPS:MinICScore=39.292
6605;HCD;34.948;6602;968.271;