TG004675

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4F]ITEENVQNMNNAGDKWSAFLK.E (PE001764)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4F (N27)
Mod(s)
Molecular Weight 7,268.193
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.585 71.195 144.898 1,451.044 5+ 1,462.677 4+ Y[pN] 54.8
71.585 71.195 144.898 1,451.044 5+ 1,685.756 4+ Y[pH3N3] 20.3
71.585 71.195 144.898 1,451.044 5+ 1,722.270 4+ Y[pH3N3F] 19.5
71.585 71.195 144.898 1,451.044 5+ 1,499.191 4+ Y[pNF]* 14.7
71.585 71.195 144.898 1,451.044 5+ 1,762.783 4+ Y[pH4N3F] 12.7
71.585 71.195 144.898 1,451.044 5+ 1,421.833 5+ Y[pH4N4] 9.4
71.585 71.195 144.898 1,451.044 5+ 1,681.757 4+ Y[pH2N3F] 8.0
71.585 71.195 144.898 1,451.044 5+ 1,634.986 4+ Y[pH3N2] 6.8
71.585 71.195 144.898 1,451.044 5+ 1,726.269 4+ Y[pH4N3] 5.9
71.585 71.195 144.898 1,451.044 5+ 1,553.960 4+ Y[pHN2] 5.8
71.585 71.195 144.898 1,451.044 5+ 1,411.907 4+ Y[p] 5.3

Spectra

14976;EThcD;71.560;14974;1451.250;Byonic:q-value=9.99e-09/GPS:MinICScore=39.966
14978;HCD;71.569;14974;1451.250;
14984;EThcD;71.593;14982;1451.048;Byonic:q-value=1.18e-08/GPS:MinICScore=36.557
14986;HCD;71.602;14982;1451.048;