TG004670

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L (PE001770)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H5N4FS (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 6,111.651
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
37.493 37.481 59.337 1,016.619 6+ 1,269.084 4+ Y[pH3N2F]* 29.8
37.493 37.481 59.337 1,016.619 6+ 1,413.344 3+ Y[pN] 20.1
37.493 37.481 59.337 1,016.619 6+ 1,360.367 4+ Y[pH4N3F] 18.3
37.493 37.481 59.337 1,016.619 6+ 1,192.056 4+ Y[pH2N2] 17.4
37.493 37.481 59.337 1,016.619 6+ 1,319.854 4+ Y[pH3N3F] 17.3
37.493 37.481 59.337 1,016.619 6+ 1,232.570 4+ Y[pH3N2] 13.0
37.493 37.481 59.337 1,016.619 6+ 1,637.759 3+ Y[pH2N2F]* 10.9
37.493 37.481 59.337 1,016.619 6+ 1,151.543 4+ Y[pHN2] 10.1
37.493 37.481 59.337 1,016.619 6+ 1,060.260 4+ Y[pN] 10.0
37.493 37.481 59.337 1,016.619 6+ 1,462.030 3+ Y[pNF]* 9.7
37.493 37.481 59.337 1,016.619 6+ 1,589.073 3+ Y[pH2N2] 9.6
37.493 37.481 59.337 1,016.619 6+ 1,096.701 5+ Y[pH3N4F] 8.7
37.493 37.481 59.337 1,016.619 6+ 1,096.775 4+ Y[pNF]* 8.7
37.493 37.481 59.337 1,016.619 6+ 1,188.058 4+ Y[pHN2F]* 8.2
37.493 37.481 59.337 1,016.619 6+ 1,535.055 3+ Y[pHN2] 7.8
37.493 37.481 59.337 1,016.619 6+ 1,283.340 4+ Y[pH3N3] 6.8
37.493 37.481 59.337 1,016.619 6+ 1,187.330 5+ Y[pH4N4FS] 6.1
37.493 37.481 59.337 1,016.619 6+ 1,111.030 4+ Y[pN2] 6.0
37.493 37.481 59.337 1,016.619 6+ 1,583.741 3+ Y[pHN2F]* 5.7
37.493 37.481 59.337 1,016.619 6+ 1,643.090 3+ Y[pH3N2] 5.5
37.493 37.481 59.337 1,016.619 6+ 1,481.037 3+ Y[pN2] 5.3
37.493 37.481 59.337 1,016.619 6+ 1,323.853 4+ Y[pH4N3] 5.1
37.493 37.481 59.337 1,016.619 6+ 1,691.776 3+ Y[pH3N2F]* 8.2

Spectra

7148;EThcD;37.341;7147;1016.620;Byonic:q-value=0.00284/GPS:MinICScore=45.000
7150;HCD;37.349;7147;1016.620;
7180;EThcD;37.484;7178;1016.786;Byonic:q-value=0.00202/GPS:MinICScore=84.506
7182;HCD;37.493;7178;1016.786;