TG004669

From GPTWiki
Jump to navigation Jump to search
Peptide R.IFKEAEKFFVSVGLPN[H3N4F]MTQGFWENSMLTDPGNVQK.A (PE001682)
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N4F (N16)
Mod(s)
Molecular Weight 5,450.498
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
66.149 65.033 129.259 1,359.130 4+ 1,744.144 3+ Y[pH3N3F] 37.4
66.149 65.033 129.259 1,359.130 4+ 1,690.126 3+ Y[pH2N3F] 21.1
66.149 65.033 129.259 1,359.130 4+ 1,695.458 3+ Y[pH3N3] 11.0
66.149 65.033 129.259 1,359.130 4+ 1,641.440 3+ Y[pH2N3] 7.5
66.149 65.033 129.259 1,359.130 4+ 1,622.433 3+ Y[pH2N2F]* 7.4
66.149 65.033 129.259 1,359.130 4+ 1,398.019 3+ Y[pN] 7.3
66.149 65.033 129.259 1,359.130 4+ 1,573.747 3+ Y[pH2N2] 6.2
66.149 65.033 129.259 1,359.130 4+ 1,446.705 3+ Y[pNF]* 5.2

Spectra

13719;EThcD;66.140;13711;1359.389;Byonic:q-value=2.57e-08/GPS:MinICScore=44.218
13721;HCD;66.149;13711;1359.389;