TG004655

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3]STEAGQK.L (PE001769)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N3 (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,147.312
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.418 35.468 54.228 855.896 6+ 1,060.260 4+ Y[pN] 96.5
35.418 35.468 54.228 855.896 6+ 953.847 5+ Y[pH2N2] 34.7
35.418 35.468 54.228 855.896 6+ 921.436 5+ Y[pHN2] 34.1
35.418 35.468 54.228 855.896 6+ 986.257 5+ Y[pH3N2] 16.1
35.418 35.468 54.228 855.896 6+ 1,151.543 4+ Y[pHN2] 15.5
35.418 35.468 54.228 855.896 6+ 1,192.056 4+ Y[pH2N2] 9.8
35.418 35.468 54.228 855.896 6+ 848.410 5+ Y[pN] 8.0
35.418 35.468 54.228 855.896 6+ 1,413.344 3+ Y[pN] 7.2

Spectra

6709;EThcD;35.399;6708;855.895;Byonic:q-value=0.00284/GPS:MinICScore=36.292
6711;HCD;35.408;6708;855.895;