TG004653

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N5]ITEENVQNMNNAGDKWSAFLK.E (PE001761)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N5 (N27)
Mod(s)
Molecular Weight 7,163.161
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.525 71.046 144.520 1,430.038 5+ 1,462.677 4+ Y[pN] 29.2
71.525 71.046 144.520 1,430.038 5+ 1,736.526 4+ Y[pH3N4] 34.6
71.525 71.046 144.520 1,430.038 5+ 1,685.756 4+ Y[pH3N3] 12.6
71.525 71.046 144.520 1,430.038 5+ 1,645.243 4+ Y[pH2N3] 9.6

Spectra

14759;EThcD;70.616;14758;1430.047;Byonic:q-value=4.81e-14/GPS:MinICScore=52.866
14760;HCD;70.623;14758;1430.047;
14967;EThcD;71.517;14962;1430.046;Byonic:q-value=4.47e-13/GPS:MinICScore=43.164
14969;HCD;71.525;14962;1430.046;
15163;EThcD;72.372;15161;1430.044;Byonic:q-value=0.000108/GPS:MinICScore=46.906
15165;HCD;72.387;15161;1430.044;