TG004640

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4F]ITEENVQNMNNAGDKWSAFLK.E (PE001757)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4F (N27)
Mod(s)
Molecular Weight 7,106.14
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.062 71.326 145.230 1,418.634 5+ 1,462.677 4+ Y[pN] 47.3
71.062 71.326 145.230 1,418.634 5+ 1,685.756 4+ Y[pH3N3] 23.4
71.062 71.326 145.230 1,418.634 5+ 1,722.270 4+ Y[pH3N3F] 21.9
71.062 71.326 145.230 1,418.634 5+ 1,499.191 4+ Y[pNF]* 12.6
71.062 71.326 145.230 1,418.634 5+ 1,594.473 4+ Y[pH2N2] 9.4
71.062 71.326 145.230 1,418.634 5+ 1,681.757 4+ Y[pH2N3F] 6.8
71.062 71.326 145.230 1,418.634 5+ 1,634.986 4+ Y[pH3N2] 6.4
71.062 71.326 145.230 1,418.634 5+ 1,513.446 4+ Y[pN2] 5.1

Spectra

14846;EThcD;70.995;14836;1419.041;Byonic:q-value=3.31e-05/GPS:MinICScore=81.685
14848;HCD;71.004;14836;1419.041;
14859;EThcD;71.054;14849;1418.840;Byonic:q-value=7.64e-08/GPS:MinICScore=79.815
14861;HCD;71.062;14849;1418.840;
14932;EThcD;71.365;14925;1418.642;Byonic:q-value=2.66e-23/GPS:MinICScore=25.810
14934;HCD;71.374;14925;1418.642;