TG004636

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4S]ITEENVQNMNNAGDKWSAFLK.E (PE001760)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4S (N27)
Mod(s)
Molecular Weight 7,413.23
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.003 74.871 154.227 1,480.052 5+ 1,462.677 4+ Y[pN] 49.6
75.003 74.871 154.227 1,480.052 5+ 1,685.756 4+ Y[pH3N3] 27.3
75.003 74.871 154.227 1,480.052 5+ 1,594.473 4+ Y[pH2N2] 9.1
75.003 74.871 154.227 1,480.052 5+ 1,799.043 4+ Y[pH4N3S] 7.7
75.003 74.871 154.227 1,480.052 5+ 1,513.446 4+ Y[pN2] 6.2
75.003 74.871 154.227 1,480.052 5+ 1,949.899 3+ Y[pN] 6.1
75.003 74.871 154.227 1,480.052 5+ 1,634.986 4+ Y[pH3N2] 6.0
75.003 74.871 154.227 1,480.052 5+ 1,421.833 5+ Y[pH4N4] 5.9

Spectra

15757;EThcD;74.995;15753;1480.059;Byonic:q-value=1.59e-19/GPS:MinICScore=31.889
15759;HCD;75.003;15753;1480.059;