TG004496

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000224)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,058.453
Charge 5+
Protein A1BG (P04217)
Spectrum File DataMS_UO1_SWATH_11202019_Erlich5
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum
Extraction OpenSWATH
Intensity 299.089
Score 2.997
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
34.974 34.974 88.746 1,209.099 5+ 1,577.008 3+ Y[pH3N2] 100.0
34.974 34.974 88.746 1,209.099 5+ 1,522.990 3+ Y[pH2N2] 84.7
34.974 34.974 88.746 1,209.099 5+ 1,698.718 3+ Y[pH4N3] 45.7
34.974 34.974 88.746 1,209.099 5+ 1,347.065 4+ Y[pH4N3S] 40.1
34.974 34.974 88.746 1,209.099 5+ 1,644.701 3+ Y[pH3N3] 26.4
34.974 34.974 88.746 1,209.099 5+ 1,438.348 4+ Y[pH5N4S] 22.1
34.974 34.974 88.746 1,209.099 5+ 1,468.972 3+ Y[pHN2] 17.7
34.974 34.974 88.746 1,209.099 5+ 1,274.291 4+ Y[pH4N3] 10.3
34.974 34.974 88.746 1,209.099 5+ 1,414.955 3+ Y[pN2] 8.9
34.974 34.974 88.746 1,209.099 5+ 1,347.262 3+ Y[pN] 1.7