TG004426

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAMLSLGTK.A (PE001185)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s)
Molecular Weight 5,403.411
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_UO1_SWATH_11202019_Erlich10
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum