TG004370

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS]FTTAPAICHDGK.A (PE001653)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,197.183
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.041 41.554 68.917 1,197.539 6+ 1,305.599 5+ Y[pH5N5F] 25.1
43.041 41.554 68.917 1,197.539 6+ 1,363.818 5+ Y[pH5N5FS] 10.1
43.041 41.554 68.917 1,197.539 6+ 1,540.464 4+ Y[pH4N4F] 7.8
43.041 41.554 68.917 1,197.539 6+ 1,200.162 5+ Y[pH3N4F] 5.5
43.041 41.554 68.917 1,197.539 6+ 1,273.189 5+ Y[pH4N5F] 5.5
43.041 41.554 68.917 1,197.539 6+ 1,499.951 4+ Y[pH3N4F] 5.4
43.041 41.554 68.917 1,197.539 6+ 1,408.668 4+ Y[pH2N3F] 5.2
43.041 41.554 68.917 1,197.539 6+ 1,189.587 4+ Y[pN] 5.1

Spectra

8944;EThcD;44.461;8939;1197.876;Byonic:q-value=0.00399/GPS:MinICScore=44.249
8946;HCD;44.470;8939;1197.876;