TG004360

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS]FTTAPAICHDGK.A (PE001653)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,197.183
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.041 41.597 69.024 1,026.606 7+ 1,088.167 6+ Y[pH5N5F] 27.9
43.041 41.597 69.024 1,026.606 7+ 1,136.683 6+ Y[pH5N5FS] 17.8
43.041 41.597 69.024 1,026.606 7+ 1,027.312 6+ Y[pH4N4F] 15.2
43.041 41.597 69.024 1,026.606 7+ 1,232.573 5+ Y[pH4N4F] 11.2
43.041 41.597 69.024 1,026.606 7+ 1,189.587 4+ Y[pN] 8.8
43.041 41.597 69.024 1,026.606 7+ 1,159.546 5+ Y[pH3N3F] 8.7
43.041 41.597 69.024 1,026.606 7+ 1,305.599 5+ Y[pH5N5F] 7.1
43.041 41.597 69.024 1,026.606 7+ 817.737 6+ Y[pNF]* 7.0
43.041 41.597 69.024 1,026.606 7+ 1,449.181 4+ Y[pH3N3F] 5.9
43.041 41.597 69.024 1,026.606 7+ 1,211.567 5+ Y[pH3N5] 5.8
43.041 41.597 69.024 1,026.606 7+ 1,200.162 5+ Y[pH3N4F] 5.7
43.041 41.597 69.024 1,026.606 7+ 1,127.136 5+ Y[pH2N3F] 5.4
43.041 41.597 69.024 1,026.606 7+ 1,009.807 6+ Y[pH3N5] 5.3
43.041 41.597 69.024 1,026.606 7+ 1,240.357 4+ Y[pN2] 5.2

Spectra

8324;EThcD;41.602;8323;1026.751;Byonic:q-value=0.00346/GPS:MinICScore=92.018
8326;HCD;41.611;8323;1026.751;