TG004356

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N6F]FTTAPAICHDGK.A (PE001654)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H3N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,419.929
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.849 39.420 63.606 915.569 7+ 1,034.150 6+ Y[pH3N5F] 26.2
39.849 39.420 63.606 915.569 7+ 1,200.162 5+ Y[pH3N4F] 10.5
39.849 39.420 63.606 915.569 7+ 1,127.136 5+ Y[pH2N3F] 7.9
39.849 39.420 63.606 915.569 7+ 1,189.587 4+ Y[pN] 5.6
39.849 39.420 63.606 915.569 7+ 1,000.303 6+ Y[pH3N4F] 5.0

Spectra

7814;EThcD;39.278;7812;915.717;Byonic:q-value=0.00399/GPS:MinICScore=141.717
7816;HCD;39.288;7812;915.717;
7877;EThcD;39.554;7874;915.573;Byonic:q-value=2.66e-07/GPS:MinICScore=41.432
7879;HCD;39.563;7874;915.573;
8000;EThcD;40.126;7995;915.574;Byonic:q-value=0.00104/GPS:MinICScore=72.199
8002;HCD;40.134;7995;915.574;
8022;EThcD;40.216;8021;915.859;Byonic:q-value=0.00104/GPS:MinICScore=62.694
8024;HCD;40.225;8021;915.859;