TG004354

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A (PE001656)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,359.236
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.342 1,224.547 6+ 1,176.032 6+ Y[pH7N6F] 35.2
42.342 1,224.547 6+ 1,338.010 5+ Y[pH6N5F] 23.4
42.342 1,224.547 6+ 1,226.102 4+ Y[pNF]* 12.3
42.342 1,224.547 6+ 1,396.229 5+ Y[pH6N5FS] 10.4
42.342 1,224.547 6+ 1,580.977 4+ Y[pH5N4F] 9.4
42.342 1,224.547 6+ 1,449.181 4+ Y[pH3N3F] 6.8
42.342 1,224.547 6+ 1,232.573 5+ Y[pH4N4F] 5.4

Spectra

8285;EThcD;41.430;8275;1224.553;Byonic:q-value=1.42e-10/GPS:MinICScore=31.826
8287;HCD;41.438;8275;1224.553;
8862;EThcD;44.058;8857;1224.548;Byonic:q-value=2.01e-08/GPS:MinICScore=69.953
8864;HCD;44.067;8857;1224.548;
9243;EThcD;45.868;9234;1224.553;Byonic:q-value=0.000257/GPS:MinICScore=87.475
9245;HCD;45.876;9234;1224.553;