TG004349

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A (PE001656)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,359.236
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.082 40.477 1,224.547 6+ 1,176.032 6+ Y[pH7N6F] 20.0
42.082 40.477 1,224.547 6+ 1,338.010 5+ Y[pH6N5F] 12.0
42.082 40.477 1,224.547 6+ 1,226.102 4+ Y[pNF]* 5.1
42.082 40.477 1,224.547 6+ 1,396.229 5+ Y[pH6N5FS] 6.5

Spectra

8256;EThcD;41.813;8251;1224.553;Byonic:q-value=9.03e-14/GPS:MinICScore=30.918
8258;HCD;41.822;8251;1224.553;
8479;EThcD;42.795;8470;1224.555;Byonic:q-value=7.82e-13/GPS:MinICScore=28.061
8481;HCD;42.804;8470;1224.555;
9010;EThcD;45.127;9000;1224.553;Byonic:q-value=8.05e-10/GPS:MinICScore=47.578
9012;HCD;45.136;9000;1224.553;