TG004348

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N6F]FTTAPAICHDGK.A (PE001654)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H3N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,419.929
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.222 915.569 7+ 1,034.150 6+ Y[pH3N5F] 25.1
39.222 915.569 7+ 1,200.162 5+ Y[pH3N4F] 11.2
39.222 915.569 7+ 1,127.136 5+ Y[pH2N3F] 7.4
39.222 915.569 7+ 1,189.587 4+ Y[pN] 6.0

Spectra

7591;EThcD;38.857;7581;915.716;Byonic:q-value=6.19e-06/GPS:MinICScore=43.261
7593;HCD;38.865;7581;915.716;