TG004343

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS]FTTAPAICHDGK.A (PE001653)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,197.183
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.544 40.922 67.760 1,197.539 6+ 1,305.599 5+ Y[pH5N5F] 21.8
43.544 40.922 67.760 1,197.539 6+ 1,363.818 5+ Y[pH5N5FS] 8.3
43.544 40.922 67.760 1,197.539 6+ 1,540.464 4+ Y[pH4N4F] 7.8
43.544 40.922 67.760 1,197.539 6+ 1,200.162 5+ Y[pH3N4F] 6.4

Spectra

8649;EThcD;43.535;8640;1198.047;Byonic:q-value=0.000751/GPS:MinICScore=202.518
8651;HCD;43.544;8640;1198.047;
8713;EThcD;43.817;8704;1197.710;Byonic:q-value=0.000751/GPS:MinICScore=61.579
8715;HCD;43.825;8704;1197.710;