TG004342

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A (PE001656)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,359.236
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.082 40.465 66.611 1,049.756 7+ 1,115.176 6+ Y[pH6N5F] 16.4
42.082 40.465 66.611 1,049.756 7+ 1,163.692 6+ Y[pH6N5FS] 10.8
42.082 40.465 66.611 1,049.756 7+ 1,276.872 4+ Y[pN2F]* 7.2
42.082 40.465 66.611 1,049.756 7+ 1,276.388 5+ Y[pH5N5] 7.2
42.082 40.465 66.611 1,049.756 7+ 1,264.983 5+ Y[pH5N4F] 7.1
42.082 40.465 66.611 1,049.756 7+ 1,176.032 6+ Y[pH7N6F] 6.2

Spectra

8253;EThcD;41.798;8251;1049.761;Byonic:q-value=2.68e-08/GPS:MinICScore=212.615
8255;HCD;41.808;8251;1049.761;
8369;EThcD;42.310;8367;1049.762;Byonic:q-value=2.54e-10/GPS:MinICScore=37.101
8371;HCD;42.320;8367;1049.762;