TG004341

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N6F]FTTAPAICHDGK.A (PE001654)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H3N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,419.929
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.222 38.872 62.604 1,067.996 6+ 1,240.357 4+ Y[pN2] 34.2
39.222 38.872 62.604 1,067.996 6+ 1,034.150 6+ Y[pH3N5F] 12.3
39.222 38.872 62.604 1,067.996 6+ 1,200.162 5+ Y[pH3N4F] 10.9
39.222 38.872 62.604 1,067.996 6+ 1,167.752 5+ Y[pH2N4F] 10.6
39.222 38.872 62.604 1,067.996 6+ 1,499.951 4+ Y[pH3N4F] 9.1
39.222 38.872 62.604 1,067.996 6+ 1,408.668 4+ Y[pH2N3F] 8.8
39.222 38.872 62.604 1,067.996 6+ 1,189.587 4+ Y[pN] 7.1
39.222 38.872 62.604 1,067.996 6+ 1,127.136 5+ Y[pH2N3F] 6.3
39.222 38.872 62.604 1,067.996 6+ 1,585.780 3+ Y[pN] 5.4
39.222 38.872 62.604 1,067.996 6+ 1,449.181 4+ Y[pH3N3F] 5.3

Spectra

7757;EThcD;39.571;7748;1068.002;Byonic:q-value=5.91e-05/GPS:MinICScore=50.710
7759;HCD;39.580;7748;1068.002;