TG004334

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A (PE001656)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,359.236
Charge 5+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.082 41.517 69.257 1,469.255 5+ 1,411.036 5+ Y[pH7N6F] 61.1
42.082 41.517 69.257 1,469.255 5+ 1,672.260 4+ Y[pH6N5F] 24.1
42.082 41.517 69.257 1,469.255 5+ 1,412.667 4+ Y[pH3N3] 11.3
42.082 41.517 69.257 1,469.255 5+ 1,338.010 5+ Y[pH6N5F] 9.1
42.082 41.517 69.257 1,469.255 5+ 1,540.464 4+ Y[pH4N4F] 7.9
42.082 41.517 69.257 1,469.255 5+ 1,745.034 4+ Y[pH6N5FS] 7.3
42.082 41.517 69.257 1,469.255 5+ 1,396.229 5+ Y[pH6N5FS] 5.8
42.082 41.517 69.257 1,469.255 5+ 1,580.977 4+ Y[pH5N4F] 5.6

Spectra

8261;EThcD;41.835;8251;1469.262;Byonic:q-value=6.12e-06/GPS:MinICScore=31.437
8263;HCD;41.844;8251;1469.262;