TG004293

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5F]FTTAPAICHDGK.A (PE001548)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,703.008
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
40.141 40.538 66.388 1,115.176 6+ 1,264.983 5+ Y[pH5N4F] 33.8
40.141 40.538 66.388 1,115.176 6+ 1,159.546 5+ Y[pH3N3F] 9.4
40.141 40.538 66.388 1,115.176 6+ 1,449.181 4+ Y[pH3N3F] 7.3
40.141 40.538 66.388 1,115.176 6+ 1,232.573 5+ Y[pH4N4F] 6.9
40.141 40.538 66.388 1,115.176 6+ 1,189.587 4+ Y[pN] 6.0
40.141 40.538 66.388 1,115.176 6+ 1,357.898 4+ Y[pH2N2F]* 5.2
40.141 40.538 66.388 1,115.176 6+ 1,321.383 4+ Y[pH2N2] 5.2
40.141 40.538 66.388 1,115.176 6+ 1,088.167 6+ Y[pH5N5F] 5.0

Spectra

7981;EThcD;40.032;7971;1115.185;Byonic:q-value=0.00346/GPS:MinICScore=28.513
7983;HCD;40.040;7971;1115.185;
8026;EThcD;40.234;8021;1115.514;Byonic:q-value=0.00104/GPS:MinICScore=37.018
8028;HCD;40.242;8021;1115.514;