TG004281

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N6F]FTTAPAICHDGK.A (PE001551)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H5N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,744.034
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.355 39.256 63.198 961.870 7+ 1,061.159 6+ Y[pH4N5F] 33.6
39.355 39.256 63.198 961.870 7+ 1,200.162 5+ Y[pH3N4F] 12.2
39.355 39.256 63.198 961.870 7+ 1,232.573 5+ Y[pH4N4F] 11.5
39.355 39.256 63.198 961.870 7+ 1,189.587 4+ Y[pN] 10.3
39.355 39.256 63.198 961.870 7+ 1,127.136 5+ Y[pH2N3F] 8.5
39.355 39.256 63.198 961.870 7+ 1,179.156 5+ Y[pH2N5]* 7.7
39.355 39.256 63.198 961.870 7+ 817.737 6+ Y[pNF] 6.2
39.355 39.256 63.198 961.870 7+ 951.871 5+ Y[pN] 6.2
39.355 39.256 63.198 961.870 7+ 1,408.668 4+ Y[pH2N3F] 5.3
39.355 39.256 63.198 961.870 7+ 1,449.181 4+ Y[pH3N3F] 5.1

Spectra

7830;EThcD;39.346;7825;962.018;Byonic:q-value=0.00104/GPS:MinICScore=71.513
7832;HCD;39.355;7825;962.018;