TG004280

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6F]FTTAPAICHDGK.A (PE001617)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,068.14
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.695 43.635 74.096 1,176.032 6+ 1,338.010 5+ Y[pH6N5F] 34.0
43.695 43.635 74.096 1,176.032 6+ 1,449.181 4+ Y[pH3N3F] 9.8
43.695 43.635 74.096 1,176.032 6+ 1,232.573 5+ Y[pH4N4F] 7.1
43.695 43.635 74.096 1,176.032 6+ 1,264.983 5+ Y[pH5N4F] 5.9
43.695 43.635 74.096 1,176.032 6+ 1,115.176 6+ Y[pH6N5F] 5.3

Spectra

8781;EThcD;43.686;8775;1176.203;Byonic:q-value=9.23e-05/GPS:MinICScore=27.433
8783;HCD;43.695;8775;1176.203;
8859;EThcD;44.044;8857;1176.039;Byonic:q-value=0.000256/GPS:MinICScore=31.155
8861;HCD;44.054;8857;1176.039;