TG004247

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N3]FTTAPAICHDGK.A (PE001544)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N3 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,150.791
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.882 39.764 64.462 877.121 7+ 962.285 6+ Y[pH5N2] 62.7
39.882 39.764 64.462 877.121 7+ 951.871 5+ Y[pN] 41.7
39.882 39.764 64.462 877.121 7+ 935.276 6+ Y[pH4N2] 30.9
39.882 39.764 64.462 877.121 7+ 1,057.308 5+ Y[pH2N2] 10.1
39.882 39.764 64.462 877.121 7+ 881.258 6+ Y[pH2N2] 9.3
39.882 39.764 64.462 877.121 7+ 1,189.587 4+ Y[pN] 8.9
39.882 39.764 64.462 877.121 7+ 854.249 6+ Y[pHN2] 7.8
39.882 39.764 64.462 877.121 7+ 992.487 5+ Y[pN2] 7.3
39.882 39.764 64.462 877.121 7+ 793.394 6+ Y[pN] 7.1
39.882 39.764 64.462 877.121 7+ 996.131 6+ Y[pH5N3] 6.9
39.882 39.764 64.462 877.121 7+ 827.241 6+ Y[pN2] 6.2
39.882 39.764 64.462 877.121 7+ 1,122.129 5+ Y[pH4N2] 5.1

Spectra

7947;EThcD;39.873;7946;877.125;Byonic:q-value=0.00104/GPS:MinICScore=54.987
7949;HCD;39.882;7946;877.125;