TG004246

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS2]FTTAPAICHDGK.A (PE001554)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5FS2 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,285.199
Charge 5+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.393 44.185 75.465 1,454.448 5+ 1,396.229 5+ Y[pH6N5FS] 96.0
44.393 44.185 75.465 1,454.448 5+ 1,338.010 5+ Y[pH6N5F] 46.9
44.393 44.185 75.465 1,454.448 5+ 1,580.977 4+ Y[pH5N4F] 16.7
44.393 44.185 75.465 1,454.448 5+ 1,449.181 4+ Y[pH3N3F] 15.7
44.393 44.185 75.465 1,454.448 5+ 1,453.180 4+ Y[pH4N3] 10.6
44.393 44.185 75.465 1,454.448 5+ 1,653.751 4+ Y[pH5N4FS] 6.9
44.393 44.185 75.465 1,454.448 5+ 1,226.102 4+ Y[pNF]* 6.1
44.393 44.185 75.465 1,454.448 5+ 1,305.599 5+ Y[pH5N5F] 5.4
44.393 44.185 75.465 1,454.448 5+ 1,653.473 3+ Y[pN2] 5.1
44.393 44.185 75.465 1,454.448 5+ 1,540.464 4+ Y[pH4N4F] 5.1

Spectra

8930;EThcD;44.384;8929;1454.456;Byonic:q-value=0.00346/GPS:MinICScore=28.651
8932;HCD;44.393;8929;1454.456;