TG004234

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A (PE001616)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H5N3 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 5,988.738
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
40.006 40.131 65.376 853.971 7+ 935.276 6+ Y[pH4N2] 68.3
40.006 40.131 65.376 853.971 7+ 908.267 6+ Y[pH3N2] 33.6
40.006 40.131 65.376 853.971 7+ 992.487 5+ Y[pN2] 9.8
40.006 40.131 65.376 853.971 7+ 1,189.587 4+ Y[pN] 7.1
40.006 40.131 65.376 853.971 7+ 969.122 6+ Y[pH4N3] 6.6
40.006 40.131 65.376 853.971 7+ 911.255 5+ Y[p] 6.2
40.006 40.131 65.376 853.971 7+ 830.820 7+ Y[pH4N3] 5.2

Spectra

7973;EThcD;39.997;7971;854.118;Byonic:q-value=0.00104/GPS:MinICScore=24.015
7975;HCD;40.006;7971;854.118;