TG004205

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS]FTTAPAICHDGK.A (PE001618)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,994.103
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.913 41.647 69.148 1,163.692 6+ 1,115.176 6+ Y[pH6N5F] 44.9
42.913 41.647 69.148 1,163.692 6+ 1,264.983 5+ Y[pH5N4F] 25.5
42.913 41.647 69.148 1,163.692 6+ 1,159.546 5+ Y[pH3N3F] 9.9
42.913 41.647 69.148 1,163.692 6+ 1,489.694 4+ Y[pH4N3F] 8.7
42.913 41.647 69.148 1,163.692 6+ 1,162.745 5+ Y[pH4N3] 7.5
42.913 41.647 69.148 1,163.692 6+ 1,323.202 5+ Y[pH5N4FS] 6.9
42.913 41.647 69.148 1,163.692 6+ 1,449.181 4+ Y[pH3N3F] 6.6
42.913 41.647 69.148 1,163.692 6+ 1,232.573 5+ Y[pH4N4F] 6.4
42.913 41.647 69.148 1,163.692 6+ 1,189.587 4+ Y[pN] 6.3
42.913 41.647 69.148 1,163.692 6+ 1,357.898 4+ Y[pH2N2F] 6.1

Spectra

8492;EThcD;42.351;8486;1163.865;Byonic:q-value=3.33e-06/GPS:MinICScore=26.119
8494;HCD;42.359;8486;1163.865;
8732;EThcD;43.459;8729;1164.029;Byonic:q-value=0.00346/GPS:MinICScore=28.737
8734;HCD;43.468;8729;1164.029;