TG004183

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A (PE001542)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H4N3F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 5,972.744
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.439 39.114 63.213 993.465 6+ 1,118.930 5+ Y[pH3N2F]* 29.8
39.439 39.114 63.213 993.465 6+ 1,189.587 4+ Y[pN] 19.9
39.439 39.114 63.213 993.465 6+ 1,151.341 5+ Y[pH4N2F]* 18.5
39.439 39.114 63.213 993.465 6+ 1,086.520 5+ Y[pH2N2F]* 12.8
39.439 39.114 63.213 993.465 6+ 1,089.719 5+ Y[pH3N2] 12.8
39.439 39.114 63.213 993.465 6+ 966.457 6+ Y[pH3N3F] 12.2
39.439 39.114 63.213 993.465 6+ 951.871 5+ Y[pN] 12.1
39.439 39.114 63.213 993.465 6+ 1,402.410 4+ Y[pH4N2]* 9.9
39.439 39.114 63.213 993.465 6+ 1,057.308 5+ Y[pH2N2] 9.8
39.439 39.114 63.213 993.465 6+ 992.487 5+ Y[pN2] 8.7
39.439 39.114 63.213 993.465 6+ 1,226.102 4+ Y[pNF]* 7.8
39.439 39.114 63.213 993.465 6+ 981.083 5+ Y[pNF]* 7.3
39.439 39.114 63.213 993.465 6+ 1,321.383 4+ Y[pH2N2] 5.7
39.439 39.114 63.213 993.465 6+ 1,122.129 5+ Y[pH4N2]* 5.7
39.439 39.114 63.213 993.465 6+ 1,585.780 3+ Y[pN] 5.1

Spectra

7739;EThcD;39.492;7735;993.637;Byonic:q-value=0.00377/GPS:MinICScore=19.263
7741;HCD;39.501;7735;993.637;