TG004177

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6F]FTTAPAICHDGK.A (PE001552)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,906.087
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.306 985.021 7+ 1,088.167 6+ Y[pH5N5F] 39.1
39.306 985.021 7+ 1,232.573 5+ Y[pH4N4F] 14.5
39.306 985.021 7+ 1,189.587 4+ Y[pN] 8.9
39.306 985.021 7+ 1,200.162 5+ Y[pH3N4F] 6.1
39.306 985.021 7+ 817.737 6+ Y[pNF]* 5.6
39.306 985.021 7+ 1,061.159 6+ Y[pH4N5F] 10.3

Spectra

7480;EThcD;38.369;7478;985.026;Byonic:q-value=4.02e-08/GPS:MinICScore=58.797
7482;HCD;38.378;7478;985.026;
7694;EThcD;39.298;7686;985.167;Byonic:q-value=0.000751/GPS:MinICScore=42.706
7696;HCD;39.306;7686;985.167;