TG004174

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS2]FTTAPAICHDGK.A (PE001554)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5FS2 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,285.199
Charge 5+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.219 43.714 74.783 1,454.448 5+ 1,396.229 5+ Y[pH6N5FS] 100.0
44.219 43.714 74.783 1,454.448 5+ 1,338.010 5+ Y[pH6N5F] 51.9
44.219 43.714 74.783 1,454.448 5+ 1,449.181 4+ Y[pH3N3F] 19.1
44.219 43.714 74.783 1,454.448 5+ 1,580.977 4+ Y[pH5N4F] 17.6
44.219 43.714 74.783 1,454.448 5+ 1,453.180 4+ Y[pH4N3] 11.4
44.219 43.714 74.783 1,454.448 5+ 1,305.599 5+ Y[pH5N5F] 7.8
44.219 43.714 74.783 1,454.448 5+ 1,653.473 3+ Y[pN2] 6.5
44.219 43.714 74.783 1,454.448 5+ 1,226.102 4+ Y[pNF]* 6.0
44.219 43.714 74.783 1,454.448 5+ 1,540.464 4+ Y[pH4N4F] 5.2

Spectra

8802;EThcD;44.211;8794;1454.852;Byonic:q-value=0.00802/GPS:MinICScore=29.711
8804;HCD;44.219;8794;1454.852;