TG004169

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS3]FTTAPAICHDGK.A (PE001546)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS3 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,941.426
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
46.622 46.629 82.115 1,132.926 7+ 1,163.692 6+ Y[pH6N5FS] 16.3
46.622 46.629 82.115 1,132.926 7+ 1,212.208 6+ Y[pH6N5FS2] 11.1
46.622 46.629 82.115 1,132.926 7+ 1,224.547 6+ Y[pH7N6FS] 8.8
46.622 46.629 82.115 1,132.926 7+ 1,115.176 6+ Y[pH6N5F] 8.4
46.622 46.629 82.115 1,132.926 7+ 1,211.567 5+ Y[pH3N5] 6.9
46.622 46.629 82.115 1,132.926 7+ 1,264.983 5+ Y[pH5N4F] 5.7
46.622 46.629 82.115 1,132.926 7+ 1,273.063 6+ Y[pH7N6FS2] 5.1

Spectra

9349;EThcD;46.613;9343;1132.933;Byonic:q-value=3.25e-07/GPS:MinICScore=66.931
9351;HCD;46.622;9343;1132.933;