TG004164

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N4F]FTTAPAICHDGK.A (PE001553)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H5N4F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,337.876
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.000 38.893 62.657 1,054.321 6+ 1,054.109 5+ Y[pHN2F]* 73.1
39.000 38.893 62.657 1,054.321 6+ 1,191.957 5+ Y[pH4N3F] 38.9
39.000 38.893 62.657 1,054.321 6+ 1,159.546 5+ Y[pH3N3F] 15.9
39.000 38.893 62.657 1,054.321 6+ 1,189.587 4+ Y[pN] 14.7
39.000 38.893 62.657 1,054.321 6+ 1,357.898 4+ Y[pH2N2F]* 8.0
39.000 38.893 62.657 1,054.321 6+ 1,321.383 4+ Y[pH2N2] 8.0
39.000 38.893 62.657 1,054.321 6+ 1,226.102 4+ Y[pNF]* 7.0
39.000 38.893 62.657 1,054.321 6+ 1,027.312 6+ Y[pH4N4F] 5.9
39.000 38.893 62.657 1,054.321 6+ 1,130.335 5+ Y[pH3N3] 5.6
39.000 38.893 62.657 1,054.321 6+ 1,162.745 5+ Y[pH4N3] 5.4

Spectra

7657;EThcD;39.140;7647;1054.657;Byonic:q-value=4.67e-08/GPS:MinICScore=23.485
7659;HCD;39.149;7647;1054.657;