TG004143

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A (PE001542)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H4N3F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 5,972.744
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.439 40.360 66.347 851.686 7+ 932.610 6+ Y[pH3N2F]* 41.9
39.439 40.360 66.347 851.686 7+ 951.871 5+ Y[pN] 40.9
39.439 40.360 66.347 851.686 7+ 827.241 6+ Y[pN2] 19.6
39.439 40.360 66.347 851.686 7+ 981.083 5+ Y[pNF]* 17.6
39.439 40.360 66.347 851.686 7+ 881.258 6+ Y[pH2N2] 13.3
39.439 40.360 66.347 851.686 7+ 908.267 6+ Y[pH3N2] 11.6
39.439 40.360 66.347 851.686 7+ 1,189.587 4+ Y[pN] 11.5
39.439 40.360 66.347 851.686 7+ 992.487 5+ Y[pN2] 9.7
39.439 40.360 66.347 851.686 7+ 793.394 6+ Y[pN] 9.0
39.439 40.360 66.347 851.686 7+ 817.737 6+ Y[pNF]* 8.2
39.439 40.360 66.347 851.686 7+ 1,057.308 5+ Y[pH2N2] 7.7
39.439 40.360 66.347 851.686 7+ 878.592 6+ Y[pHN2F]* 7.1
39.439 40.360 66.347 851.686 7+ 935.276 6+ Y[pH4N2]* 5.7

Spectra

7711;EThcD;39.368;7710;851.976;Byonic:q-value=0.00802/GPS:MinICScore=145.999
7713;HCD;39.377;7710;851.976;