TG004106

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N5F]FTTAPAICHDGK.A (PE001556)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H3N5F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,216.849
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.084 39.280 63.630 1,034.150 6+ 1,200.162 5+ Y[pH3N4F] 38.8
39.084 39.280 63.630 1,034.150 6+ 1,127.136 5+ Y[pH2N3F] 14.8
39.084 39.280 63.630 1,034.150 6+ 1,189.587 4+ Y[pN] 13.9
39.084 39.280 63.630 1,034.150 6+ 1,167.752 5+ Y[pH2N4F] 9.8
39.084 39.280 63.630 1,034.150 6+ 1,159.546 5+ Y[pH3N3F] 8.2
39.084 39.280 63.630 1,034.150 6+ 1,226.102 4+ Y[pNF] 7.5
39.084 39.280 63.630 1,034.150 6+ 1,408.668 4+ Y[pH2N3F] 7.0
39.084 39.280 63.630 1,034.150 6+ 1,280.870 4+ Y[pHN2] 5.6
39.084 39.280 63.630 1,034.150 6+ 1,170.951 5+ Y[pH3N4] 5.3
39.084 39.280 63.630 1,034.150 6+ 951.871 5+ Y[pN] 5.2

Spectra

7630;EThcD;39.024;7622;1034.153;Byonic:q-value=6.17e-05/GPS:MinICScore=39.702
7632;HCD;39.032;7622;1034.153;
7654;EThcD;39.127;7647;1034.321;Byonic:q-value=8.42e-05/GPS:MinICScore=36.192
7656;HCD;39.136;7647;1034.321;