TG004064

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N3]FTTAPAICHDGK.A (PE001544)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N3 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,150.791
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.335 41.197 68.452 877.121 7+ 962.285 6+ Y[pH5N2] 88.6
39.335 41.197 68.452 877.121 7+ 951.871 5+ Y[pN] 72.0
39.335 41.197 68.452 877.121 7+ 935.276 6+ Y[pH4N2] 57.7
39.335 41.197 68.452 877.121 7+ 881.258 6+ Y[pH2N2] 19.0
39.335 41.197 68.452 877.121 7+ 1,189.587 4+ Y[pN] 16.3
39.335 41.197 68.452 877.121 7+ 1,057.308 5+ Y[pH2N2] 15.3
39.335 41.197 68.452 877.121 7+ 992.487 5+ Y[pN2] 15.2
39.335 41.197 68.452 877.121 7+ 1,024.898 5+ Y[pHN2] 14.8
39.335 41.197 68.452 877.121 7+ 827.241 6+ Y[pN2] 13.2
39.335 41.197 68.452 877.121 7+ 854.249 6+ Y[pHN2] 12.4
39.335 41.197 68.452 877.121 7+ 996.131 6+ Y[pH5N3] 12.3
39.335 41.197 68.452 877.121 7+ 793.394 6+ Y[pN] 9.2
39.335 41.197 68.452 877.121 7+ 1,122.129 5+ Y[pH4N2] 7.3
39.335 41.197 68.452 877.121 7+ 911.255 5+ Y[p] 6.2
39.335 41.197 68.452 877.121 7+ 969.122 6+ Y[pH4N3] 5.5

Spectra

7701;EThcD;39.326;7698;877.124;Byonic:q-value=0.000751/GPS:MinICScore=32.098
7703;HCD;39.335;7698;877.124;