TG004063

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6F]FTTAPAICHDGK.A (PE001552)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,906.087
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.306 38.880 62.624 1,149.023 6+ 1,305.599 5+ Y[pH5N5F] 36.5
39.306 38.880 62.624 1,149.023 6+ 1,200.162 5+ Y[pH3N4F] 5.9
39.306 38.880 62.624 1,149.023 6+ 1,122.014 6+ Y[pH5N6F] 5.5
39.306 38.880 62.624 1,149.023 6+ 1,449.181 4+ Y[pH3N3F] 5.4
39.306 38.880 62.624 1,149.023 6+ 1,408.668 4+ Y[pH2N3F] 5.3

Spectra

7825;EThcD;39.888;7820;1149.360;Byonic:q-value=0.000751/GPS:MinICScore=25.289
7827;HCD;39.897;7820;1149.360;