TG003729

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_48_UO1_Erlic_W5
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
45.131 44.986 76.606 1,240.319 5+ 1,629.041 3+ Y[pH3N2] 27.8
45.131 44.986 76.606 1,240.319 5+ 1,575.024 3+ Y[pH2N2] 23.8
45.131 44.986 76.606 1,240.319 5+ 1,399.295 3+ Y[pN] 21.3
45.131 44.986 76.606 1,240.319 5+ 1,386.090 4+ Y[pH4N3S] 16.4
45.131 44.986 76.606 1,240.319 5+ 1,049.724 4+ Y[pN] 11.0
45.131 44.986 76.606 1,240.319 5+ 1,521.006 3+ Y[pHN2] 7.5
45.131 44.986 76.606 1,240.319 5+ 1,345.577 4+ Y[pH3N3S] 5.9
45.131 44.986 76.606 1,240.319 5+ 1,750.752 3+ Y[pH4N3] 5.7

Spectra

10050;EThcD;45.125;10045;1240.723;Byonic:q-value=3.07e-05/GPS:MinICScore=105.794
10052;HCD;45.131;10045;1240.723;