TG003563

From GPTWiki
Jump to navigation Jump to search
Peptide K.GSFPWQAKMVSHHN[H5N4S2]LTTGATLINEQWLLTTAK.N (PE001433)
Sequence GSFPWQAKMVSHHNLTTGATLINEQWLLTTAK
Glycans(s) H5N4S2 (N14)
Mod(s)
Molecular Weight 5,802.613
Charge 5+
Protein HP (P00738)
Spectrum File MS_48_UO1_Erlic_E9
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.585 52.641 93.426 1,157.928 5+ 1,437.706 3+ Y[pH2N2] 23.8
52.585 52.641 93.426 1,157.928 5+ 1,491.723 3+ Y[pH3N2] 17.8
52.585 52.641 93.426 1,157.928 5+ 1,261.978 3+ Y[pN] 15.3
52.585 52.641 93.426 1,157.928 5+ 1,613.434 3+ Y[pH4N3] 13.2
52.585 52.641 93.426 1,157.928 5+ 1,261.097 4+ Y[pH4N4] 12.8
52.585 52.641 93.426 1,157.928 5+ 1,099.709 5+ Y[pH5N4S] 10.5
52.585 52.641 93.426 1,157.928 5+ 1,559.417 3+ Y[pH3N3] 8.5
52.585 52.641 93.426 1,157.928 5+ 1,383.688 3+ Y[pHN2] 8.5
52.585 52.641 93.426 1,157.928 5+ 1,301.611 4+ Y[pH5N4] 8.4
52.585 52.641 93.426 1,157.928 5+ 1,210.328 4+ Y[pH4N3] 7.9
52.585 52.641 93.426 1,157.928 5+ 1,283.101 4+ Y[pH4N3S] 7.5
52.585 52.641 93.426 1,157.928 5+ 1,329.671 3+ Y[pN2] 6.2

Spectra

8795;EThcD;52.564;8794;1157.935;Byonic:q-value=0.000309/GPS:MinICScore=33.997
8797;HCD;52.585;8794;1157.935;