TG003439

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H6N5FS2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001389)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5FS2 (N5)
Mod(s)
Molecular Weight 7,371.236
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
68.807 68.840 140.411 1,471.653 5+ 1,614.455 3+ Y[pN] 14.0
68.807 68.840 140.411 1,471.653 5+ 1,470.687 4+ Y[pH3N3F] 11.4
68.807 68.840 140.411 1,471.653 5+ 1,434.173 4+ Y[pH3N3] 8.6
68.807 68.840 140.411 1,471.653 5+ 1,565.969 4+ Y[pH5N4] 7.0
68.807 68.840 140.411 1,471.653 5+ 1,790.184 3+ Y[pH2N2] 6.6
68.807 68.840 140.411 1,471.653 5+ 1,211.093 4+ Y[pN] 6.0
68.807 68.840 140.411 1,471.653 5+ 1,675.257 4+ Y[pH5N4FS] 5.8

Spectra

17547;EThcD;68.712;17536;1472.061;Byonic:q-value=3.48e-09/GPS:MinICScore=164.314
17549;HCD;68.718;17536;1472.061;
17604;EThcD;68.891;17602;1471.862;Byonic:q-value=0.00105/GPS:MinICScore=79.843
17606;HCD;68.897;17602;1471.862;