TG003434

From GPTWiki
Jump to navigation Jump to search
Peptide K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S]K.S (PE001381)
Sequence IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNK
Glycans(s) H5N4S (N33)
Mod(s) 57.021 (C22)
Molecular Weight 5,547.429
Charge 5+
Protein TF (P02787)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
61.814 61.853 122.174 1,106.894 5+ 1,273.952 3+ Y[pN] 30.6
61.814 61.853 122.174 1,106.894 5+ 1,503.698 3+ Y[pH3N2] 9.4
61.814 61.853 122.174 1,106.894 5+ 1,449.681 3+ Y[pH2N2] 9.3
61.814 61.853 122.174 1,106.894 5+ 1,910.424 2+ Y[pN] 8.8
61.814 61.853 122.174 1,106.894 5+ 1,206.259 3+ Y[p] 6.1
61.814 61.853 122.174 1,106.894 5+ 1,395.663 3+ Y[pHN2] 5.9
61.814 61.853 122.174 1,106.894 5+ 1,571.391 3+ Y[pH3N3] 5.2

Spectra

15483;EThcD;61.799;15476;1106.894;Byonic:q-value=1.25e-06/GPS:MinICScore=179.318
15485;HCD;61.804;15476;1106.894;