TG003392

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H8N7F]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001388)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H8N7F (N5)
Mod(s)
Molecular Weight 7,519.31
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.044 74.532 155.268 1,501.268 5+ 1,614.455 3+ Y[pN] 12.6
74.044 74.532 155.268 1,501.268 5+ 1,790.184 3+ Y[pH2N2] 7.2
74.044 74.532 155.268 1,501.268 5+ 1,211.093 4+ Y[pN] 7.0
74.044 74.532 155.268 1,501.268 5+ 1,434.173 4+ Y[pH3N3] 6.3

Spectra

19176;EThcD;74.038;19169;1501.269;Byonic:q-value=4.61e-07/GPS:MinICScore=134.111
19178;HCD;74.044;19169;1501.269;