TG003362

From GPTWiki
Jump to navigation Jump to search
Peptide R.FSLLGHASISCTVEN[H6N5S3]ETIGVWRPSPPTCEK.I (PE000129)
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H6N5S3 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 6,250.638
Charge 5+
Protein C4BPA (P04003)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
56.384 56.270 107.602 1,247.538 5+ 1,249.566 4+ Y[pH5N4] 28.2
56.384 56.270 107.602 1,247.538 5+ 1,192.585 3+ Y[pN] 21.2
56.384 56.270 107.602 1,247.538 5+ 1,544.042 3+ Y[pH4N3] 9.4
56.384 56.270 107.602 1,247.538 5+ 1,490.024 3+ Y[pH3N3] 9.3
56.384 56.270 107.602 1,247.538 5+ 1,368.314 3+ Y[pH2N2] 7.6
56.384 56.270 107.602 1,247.538 5+ 1,665.753 3+ Y[pH5N4] 5.6

Spectra

13833;EThcD;56.378;13831;1247.937;Byonic:q-value=5.1e-10/GPS:MinICScore=188.743
13835;HCD;56.384;13831;1247.937;