TG003351

From GPTWiki
Jump to navigation Jump to search
Peptide K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S2]K.S (PE001380)
Sequence IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNK
Glycans(s) H5N4S2 (N33)
Mod(s) 57.021 (C22)
Molecular Weight 5,838.524
Charge 4+
Protein TF (P02787)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
67.333 67.036 135.702 1,456.139 4+ 1,273.952 3+ Y[pN] 13.0
67.333 67.036 135.702 1,456.139 4+ 1,625.409 3+ Y[pH4N3] 9.1
67.333 67.036 135.702 1,456.139 4+ 1,722.441 3+ Y[pH4N3S] 8.2
67.333 67.036 135.702 1,456.139 4+ 1,910.424 2+ Y[pN] 6.9
67.333 67.036 135.702 1,456.139 4+ 1,571.391 3+ Y[pH3N3] 5.8

Spectra

17062;EThcD;67.122;17056;1456.141;Byonic:q-value=5.21e-15/GPS:MinICScore=40.972
17064;HCD;67.128;17056;1456.141;
17186;EThcD;67.532;17181;1456.391;Byonic:q-value=1.13e-09/GPS:MinICScore=75.078
17188;HCD;67.537;17181;1456.391;