TG003317

From GPTWiki
Jump to navigation Jump to search
Peptide K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S]K.S (PE001381)
Sequence IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNK
Glycans(s) H5N4S (N33)
Mod(s) 57.021 (C22)
Molecular Weight 5,547.429
Charge 4+
Protein TF (P02787)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
61.814 61.878 122.239 1,383.366 4+ 1,273.952 3+ Y[pN] 10.7
61.814 61.878 122.239 1,383.366 4+ 1,625.409 3+ Y[pH4N3] 9.1
61.814 61.878 122.239 1,383.366 4+ 1,910.424 2+ Y[pN] 6.7
61.814 61.878 122.239 1,383.366 4+ 1,571.391 3+ Y[pH3N3] 5.0

Spectra

15490;EThcD;61.819;15476;1383.365;Byonic:q-value=5.37e-16/GPS:MinICScore=23.311
15491;HCD;61.823;15476;1383.365;