TG003188

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000224)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,058.453
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_48_UO1_Erlic_E5
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
47.988 47.796 85.717 1,209.099 5+ 1,522.990 3+ Y[pH2N2] 23.9
47.988 47.796 85.717 1,209.099 5+ 1,577.008 3+ Y[pH3N2] 21.3
47.988 47.796 85.717 1,209.099 5+ 1,347.262 3+ Y[pN] 18.8
47.988 47.796 85.717 1,209.099 5+ 1,347.065 4+ Y[pH4N3S] 17.3
47.988 47.796 85.717 1,209.099 5+ 1,468.972 3+ Y[pHN2] 7.7
47.988 47.796 85.717 1,209.099 5+ 1,644.701 3+ Y[pH3N3] 7.1
47.988 47.796 85.717 1,209.099 5+ 1,414.955 3+ Y[pN2] 5.1

Spectra

11317;EThcD;47.991;11312;1209.103;Byonic:q-value=2.43e-19/GPS:MinICScore=24.517
11319;HCD;47.996;11312;1209.103;